PDB entry 1bno

View 1bno on RCSB PDB site
Description: nmr solution structure of the n-terminal domain of DNA polymerase beta, minimized average structure
Class: nucleotidyltransferase (DNA-binding)
Keywords: n-terminal domain, DNA polymerase beta, single-stranded DNA-binding, nucleotidyltransferase, nucleotidyltransferase (DNA-binding)
Deposited on 1996-04-25, released 1996-12-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1bnoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bnoA (A:)
    mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
    klpgvgtkiaekideflatgklrklek