PDB entry 1bin

View 1bin on RCSB PDB site
Description: leghemoglobin a (acetomet)
Class: oxygen transport
Keywords: heme, nitrogen fixation, multigene family, oxygen transport
Deposited on 1996-08-23, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leghemoglobin a
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bina_
  • Chain 'B':
    Compound: leghemoglobin a
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1binb_
  • Heterogens: ACT, SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1binA (A:)
vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg
haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk
wsdelsrawevaydelaaaikka

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1binB (B:)
vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg
haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk
wsdelsrawevaydelaaaikka