PDB entry 1be9

View 1be9 on RCSB PDB site
Description: the third pdz domain from the synaptic protein psd-95 in complex with a c-terminal peptide derived from cript.
Class: peptide recognition
Keywords: peptide recognition, protein localization
Deposited on 1998-05-20, released 1998-10-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.207
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: psd-95
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31016 (Start-117)
      • conflict (4)
      • conflict (31)
      • conflict (106-109)
      • conflict (113-116)
    Domains in SCOPe 2.05: d1be9a_
  • Chain 'B':
    Compound: cript
    Database cross-references and differences (RAF-indexed):
    • PDB 1BE9 (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1be9A (A:)
gspeflgeedipreprrivihrgstglgfniiggedgegifisfilaggpadlsgelrkg
dqilsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvnssgrivtn

    Sequence, based on observed residues (ATOM records): (download) 
    >1be9A (A:)
flgeedipreprrivihrgstglgfniiggedgegifisfilaggpadlsgelrkgdqil
svngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvnssgrivtn

  • Chain 'B':
    No sequence available.