PDB entry 1b4q

View 1b4q on RCSB PDB site
Description: Solution structure of human thioltransferase complex with glutathione
Class: oxidoreductase
Keywords: human thioltransferase, disulfide intermediate, glutathione, oxidoreductase
Deposited on 1998-12-25, released 1999-12-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (human thioltransferase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35754 (0-104)
      • engineered (6)
      • engineered (24)
      • engineered (77)
      • engineered (81)
    Domains in SCOPe 2.05: d1b4qa_
  • Heterogens: GSH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b4qA (A:)
aqefvnskiqpgkvvvfikptcpysrraqeilsqlpikqgllefvditatnhtneiqdyl
qqltgartvprvfigkdsiggssdlvslqqsgelltrlkqigalq