PDB entry 1axa

View 1axa on RCSB PDB site
Description: active-site mobility in human immunodeficiency virus type 1 protease as demonstrated by crystal structure of a28s mutant
Class: aspartyl protease
Keywords: hiv protease, mutant, x-ray, aspartic protease, hydrolase, acid proteinase, aspartyl protease
Deposited on 1997-10-13, released 1998-04-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03366 (0-98)
    • engineered (27)
  Domains in SCOPe 2.02: d1axaa_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03366 (0-98)
    • engineered (27)
  Domains in SCOPe 2.02: d1axab_
• Heterogens: U0E, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1axaA (A:)
  pqitlwqrplvtikiggqlkealldtgsddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1axaB (B:)
  pqitlwqrplvtikiggqlkealldtgsddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf