PDB entry 1aud

View 1aud on RCSB PDB site
Description: u1a-utrrna, nmr, 31 structures
Class: RNA binding protein/RNA
Keywords: complex (ribonucleoprotein/RNA), nmr, rnp domain, RNA binding protein/RNA complex
Deposited on 1997-08-22, released 1998-02-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: u1a 102
    Species: Homo sapiens [TaxId:9606]
    Gene: U1A 1-102
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-100)
      • engineered (29)
      • engineered (34)
    Domains in SCOPe 2.05: d1auda_
  • Chain 'B':
    Compound: RNA 3utr

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1audA (A:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfv
    

  • Chain 'B':
    No sequence available.