PDB entry 1aid
View 1aid on RCSB PDB site
Description: structure of a non-peptide inhibitor complexed with hiv-1 protease: developing a cycle of structure-based drug design
Class: hydrolase
Keywords: hydrolase, protease, hiv, non-peptide inhibitor, drug design
Deposited on
1997-04-16, released
1997-10-15
The last revision prior to the SCOPe 2.02 freeze date was dated
2012-02-29, with a file datestamp of
2012-02-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.174
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: human immunodeficiency virus protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1aida_ - Chain 'B':
Compound: human immunodeficiency virus protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1aidb_ - Heterogens: CL, THK, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1aidA (A:)
pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1aidB (B:)
pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf