PDB entry 1PRS

View 1PRS on RCSB PDB site
Description: nmr-derived three-dimensional solution structure of protein s complexed with calcium
Class: binding protein
Keywords: binding protein
Deposited on 1994-03-25, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: development-specific protein s
    Species: MYXOCOCCUS XANTHUS [TaxId:34]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1prsa1, d1prsa2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1prsA (A:)
manitvfynedfqgkqvdlppgnytraqlaalgienntissvkvppgvkailyqndgfag
dqievvanaeelgplnnnvssirvisvpvqprarffykeqfdgkevdlppgqytqaeler
ygidnntissvkpqglavvlfkndnfsgdtlpvnsdaptlgamnnntssiris