Lineage for d1ut5a1 (1ut5 A:186-291)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539305Fold a.60: SAM domain-like [47768] (14 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 539589Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) (S)
  5. 539590Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 539614Protein T5 5'-exonuclease [47813] (1 species)
  7. 539615Species Bacteriophage T5 [TaxId:10726] [47814] (4 PDB entries)
  8. 539622Domain d1ut5a1: 1ut5 A:186-291 [99902]
    Other proteins in same PDB: d1ut5a2, d1ut5b2

Details for d1ut5a1

PDB Entry: 1ut5 (more details), 2.75 Å

PDB Description: divalent metal ions (manganese) bound to t5 5'-exonuclease

SCOP Domain Sequences for d1ut5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ut5a1 a.60.7.1 (A:186-291) T5 5'-exonuclease {Bacteriophage T5}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiaeq

SCOP Domain Coordinates for d1ut5a1:

Click to download the PDB-style file with coordinates for d1ut5a1.
(The format of our PDB-style files is described here.)

Timeline for d1ut5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ut5a2