Lineage for d1ut5a2 (1ut5 A:20-185)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595148Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 595149Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 595179Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 595203Protein T5 5'-exonuclease [53050] (1 species)
  7. 595204Species Bacteriophage T5 [TaxId:10726] [53051] (4 PDB entries)
  8. 595211Domain d1ut5a2: 1ut5 A:20-185 [99903]
    Other proteins in same PDB: d1ut5a1, d1ut5b1

Details for d1ut5a2

PDB Entry: 1ut5 (more details), 2.75 Å

PDB Description: divalent metal ions (manganese) bound to t5 5'-exonuclease

SCOP Domain Sequences for d1ut5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ut5a2 c.120.1.2 (A:20-185) T5 5'-exonuclease {Bacteriophage T5}
rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
ighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmyehhn

SCOP Domain Coordinates for d1ut5a2:

Click to download the PDB-style file with coordinates for d1ut5a2.
(The format of our PDB-style files is described here.)

Timeline for d1ut5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ut5a1