| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) ![]() |
| Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) |
| Protein T5 5'-exonuclease [47813] (1 species) |
| Species Bacteriophage T5 [TaxId:10726] [47814] (4 PDB entries) |
| Domain d1ut5a1: 1ut5 A:186-291 [99902] Other proteins in same PDB: d1ut5a2, d1ut5b2 |
PDB Entry: 1ut5 (more details), 2.75 Å
SCOP Domain Sequences for d1ut5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ut5a1 a.60.7.1 (A:186-291) T5 5'-exonuclease {Bacteriophage T5}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiaeq
Timeline for d1ut5a1: