![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Putative GluR0 ligand binding core [102696] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102697] (2 PDB entries) |
![]() | Domain d1us4a_: 1us4 A: [99855] complexed with edo, glu has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1us4 (more details), 1.75 Å
SCOPe Domain Sequences for d1us4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1us4a_ c.94.1.1 (A:) Putative GluR0 ligand binding core {Thermus thermophilus [TaxId: 274]} aqefitigsgsttgvyfpvatgiaklvndanvgiranarstggsvaninainagefemal aqndiayyayqgccipafegkpvktiralaalypevvhvvarkdagirtvadlkgkrvvv gdvgsgteqnarqileaygltfddlgqairvsasqgiqlmqdkradalfytvglgasaiq qlalttpialvavdlnriqaiakkypfyvgfnipggtykgvdvttptvavqamliaserl seetvykfmkavfgnleafkkihpnlerffglekavkglpiplhpgaerfykeagvlk
Timeline for d1us4a_: