Lineage for d1us4a_ (1us4 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 403440Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 403441Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 403442Family c.94.1.1: Phosphate binding protein-like [53851] (26 proteins)
  6. 403778Protein Putative GluR0 ligand binding core [102696] (1 species)
  7. 403779Species Thermus thermophilus [TaxId:274] [102697] (2 PDB entries)
  8. 403781Domain d1us4a_: 1us4 A: [99855]
    complexed with egl, glu

Details for d1us4a_

PDB Entry: 1us4 (more details), 1.75 Å

PDB Description: putative glur0 ligand binding core with l-glutamate

SCOP Domain Sequences for d1us4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1us4a_ c.94.1.1 (A:) Putative GluR0 ligand binding core {Thermus thermophilus}
aqefitigsgsttgvyfpvatgiaklvndanvgiranarstggsvaninainagefemal
aqndiayyayqgccipafegkpvktiralaalypevvhvvarkdagirtvadlkgkrvvv
gdvgsgteqnarqileaygltfddlgqairvsasqgiqlmqdkradalfytvglgasaiq
qlalttpialvavdlnriqaiakkypfyvgfnipggtykgvdvttptvavqamliaserl
seetvykfmkavfgnleafkkihpnlerffglekavkglpiplhpgaerfykeagvlk

SCOP Domain Coordinates for d1us4a_:

Click to download the PDB-style file with coordinates for d1us4a_.
(The format of our PDB-style files is described here.)

Timeline for d1us4a_: