Lineage for d1urfa_ (1urf A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476004Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1476198Superfamily a.2.6: HR1 repeat [46585] (1 family) (S)
  5. 1476199Family a.2.6.1: HR1 repeat [46586] (2 proteins)
    protein kinase effector domain
    this is a repeat family; one repeat unit is 1urf A:122-199 found in domain
  6. 1476200Protein Protein kinase c-like 1, pkn/prk1 [46587] (1 species)
  7. 1476201Species Human (Homo sapiens) [TaxId:9606] [46588] (3 PDB entries)
  8. 1476203Domain d1urfa_: 1urf A: [99827]
    second HR1 domain

Details for d1urfa_

PDB Entry: 1urf (more details)

PDB Description: hr1b domain from prk1
PDB Compounds: (A:) protein kinase c-like 1

SCOPe Domain Sequences for d1urfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urfa_ a.2.6.1 (A:) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]}
gipatnlsrvaglekqlaielkvkqgaenmiqtysngstkdrkllltaqqmlqdsktkid
iirmqlrralqadqlenqaap

SCOPe Domain Coordinates for d1urfa_:

Click to download the PDB-style file with coordinates for d1urfa_.
(The format of our PDB-style files is described here.)

Timeline for d1urfa_: