Lineage for d1urfa1 (1urf A:122-199)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. Superfamily a.2.6: HR1 repeat [46585] (1 family) (S)
  5. Family a.2.6.1: HR1 repeat [46586] (2 proteins)
    protein kinase effector domain
    this is a repeat family; one repeat unit is 1urf A:122-199 found in domain
  6. Protein Protein kinase c-like 1, pkn/prk1 [46587] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [46588] (3 PDB entries)
  8. Domain d1urfa1: 1urf A:122-199 [99827]
    Other proteins in same PDB: d1urfa2
    second HR1 domain

Details for d1urfa1

PDB Entry: 1urf (more details)

PDB Description: hr1b domain from prk1
PDB Compounds: (A:) protein kinase c-like 1

SCOPe Domain Sequences for d1urfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urfa1 a.2.6.1 (A:122-199) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]}
atnlsrvaglekqlaielkvkqgaenmiqtysngstkdrkllltaqqmlqdsktkidiir
mqlrralqadqlenqaap

SCOPe Domain Coordinates for d1urfa1 are not available.

Timeline for d1urfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1urfa2