SCOPe 2.02: Domain d1uptb_: 1upt B:

Lineage for d1uptb_ (1upt B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.193: GRIP domain [101282] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.193.1: GRIP domain [101283] (1 family)

5. Family a.193.1.1: GRIP domain [101284] (1 protein)

6. Protein Golgi autoantigen, golgin-245 [101285] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101286] (2 PDB entries)

8. Domain d1uptb_: 1upt B: [99768]
   Other proteins in same PDB: d1upta_, d1uptc_, d1upte_, d1uptg_
   complexed with gtp, mg

Details for d1uptb_

PDB Entry: 1upt, 1.7 Å

PDB Description: structure of a complex of the golgin-245 grip domain with arl1

PDB Compounds: (B:) Golgi autoantigen, golgin subfamily A member 4

SCOPe Domain Sequences for d1uptb_:

Sequence; same for both SEQRES and ATOM records:

>d1uptb_ a.193.1.1 (B:) Golgi autoantigen, golgin-245 {Human (Homo sapiens) [TaxId: 9606]}
eptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmswlrsss

Timeline for d1uptb_:

• d1uptb_ first appeared in SCOP 1.67
  
• d1uptb_ appears in SCOPe 2.01
  
• d1uptb_ appears in SCOPe 2.03
  
• d1uptb_ appears in the current release, SCOPe 2.08