Lineage for d1uptb_ (1upt B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736289Fold a.193: GRIP domain [101282] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2736290Superfamily a.193.1: GRIP domain [101283] (1 family) (S)
  5. 2736291Family a.193.1.1: GRIP domain [101284] (1 protein)
  6. 2736292Protein Golgi autoantigen, golgin-245 [101285] (1 species)
  7. 2736293Species Human (Homo sapiens) [TaxId:9606] [101286] (2 PDB entries)
  8. 2736294Domain d1uptb_: 1upt B: [99768]
    Other proteins in same PDB: d1upta_, d1uptc_, d1upte_, d1uptg_
    complexed with gtp, mg

Details for d1uptb_

PDB Entry: 1upt (more details), 1.7 Å

PDB Description: structure of a complex of the golgin-245 grip domain with arl1
PDB Compounds: (B:) Golgi autoantigen, golgin subfamily A member 4

SCOPe Domain Sequences for d1uptb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uptb_ a.193.1.1 (B:) Golgi autoantigen, golgin-245 {Human (Homo sapiens) [TaxId: 9606]}
eptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmswlrsss

SCOPe Domain Coordinates for d1uptb_:

Click to download the PDB-style file with coordinates for d1uptb_.
(The format of our PDB-style files is described here.)

Timeline for d1uptb_: