Lineage for d1uplb_ (1upl B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359729Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 359730Superfamily a.118.1: ARM repeat [48371] (14 families) (S)
  5. 359904Family a.118.1.15: Mo25 protein [101407] (1 protein)
    this is a repeat family; one repeat unit is 1upl A:195-240 found in domain
  6. 359905Protein Mo25 protein [101408] (1 species)
  7. 359906Species Human (Homo sapiens) [TaxId:9606] [101409] (2 PDB entries)
  8. 359909Domain d1uplb_: 1upl B: [99760]

Details for d1uplb_

PDB Entry: 1upl (more details), 2.6 Å

PDB Description: crystal structure of mo25 alpha

SCOP Domain Sequences for d1uplb_:

Sequence, based on SEQRES records: (download)

>d1uplb_ a.118.1.15 (B:) Mo25 protein {Human (Homo sapiens)}
spadivknlkesmavlekqdisdkkaekateevsknlvamkeilygtnekepqteavaql
aqelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfml
lkgyespeialncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfkd
lltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyi
skpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskfq
ndrtedeqfndektylvkqirdlk

Sequence, based on observed residues (ATOM records): (download)

>d1uplb_ a.118.1.15 (B:) Mo25 protein {Human (Homo sapiens)}
spadivknlkesmavleteevsknlvamkeilykepqteavaqlaqelynsgllstlvad
lqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfmllkgyespeialncgim
lrecirheplakiilwseqfydffryvemstfdiasdafatfkdlltrhkllsaefleqh
ydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyiskpenlklmmnllrdk
srniqfeafhvfkvfvanpnktqpildillknqaklieflskfqndrtedeqfndektyl
vkqirdlk

SCOP Domain Coordinates for d1uplb_:

Click to download the PDB-style file with coordinates for d1uplb_.
(The format of our PDB-style files is described here.)

Timeline for d1uplb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1upla_