Lineage for d1upka_ (1upk A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006773Family a.118.1.15: Mo25 protein [101407] (2 protein domains)
    automatically mapped to Pfam PF08569
  6. 2006774Protein Mo25 protein [101408] (1 species)
  7. 2006775Species Human (Homo sapiens) [TaxId:9606] [101409] (2 PDB entries)
  8. 2006776Domain d1upka_: 1upk A: [99758]
    complexed with a C-terminal peptide of strad, chain B
    complexed with mes

Details for d1upka_

PDB Entry: 1upk (more details), 1.85 Å

PDB Description: crystal structure of mo25 in complex with a c-terminal peptide of strad
PDB Compounds: (A:) mo25 protein

SCOPe Domain Sequences for d1upka_:

Sequence, based on SEQRES records: (download)

>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]}
kspadivknlkesmavlekqdisdkkaekateevsknlvamkeilygtnekepqteavaq
laqelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfm
llkgyespeialncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfk
dlltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtky
iskpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskf
qndrtedeqfndektylvkqirdlkrpaqq

Sequence, based on observed residues (ATOM records): (download)

>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]}
kspadivknlkesmavleksdkkaekateevsknlvamkeilyqteavaqlaqelynsgl
lstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfmllkgyespei
alncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfkdlltrhklls
aefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyiskpenlklm
mnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskfqndredeqfn
dektylvkqirdlkrpaqq

SCOPe Domain Coordinates for d1upka_:

Click to download the PDB-style file with coordinates for d1upka_.
(The format of our PDB-style files is described here.)

Timeline for d1upka_: