![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.15: Mo25 protein [101407] (2 proteins) automatically mapped to Pfam PF08569 this is a repeat family; one repeat unit is 1upl A:195-240 found in domain |
![]() | Protein Mo25 protein [101408] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101409] (2 PDB entries) |
![]() | Domain d1upka_: 1upk A: [99758] complexed with a C-terminal peptide of strad, chain B complexed with mes |
PDB Entry: 1upk (more details), 1.85 Å
SCOPe Domain Sequences for d1upka_:
Sequence, based on SEQRES records: (download)
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} kspadivknlkesmavlekqdisdkkaekateevsknlvamkeilygtnekepqteavaq laqelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfm llkgyespeialncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfk dlltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtky iskpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskf qndrtedeqfndektylvkqirdlkrpaqq
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} kspadivknlkesmavleksdkkaekateevsknlvamkeilyqteavaqlaqelynsgl lstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfmllkgyespei alncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfkdlltrhklls aefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyiskpenlklm mnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskfqndredeqfn dektylvkqirdlkrpaqq
Timeline for d1upka_: