SCOPe 2.02: Domain d1uolb_: 1uol B:

Lineage for d1uolb_ (1uol B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49420] (22 PDB entries)

8. Domain d1uolb_: 1uol B: [99696]
   complexed with zn; mutant

Details for d1uolb_

PDB Entry: 1uol, 1.9 Å

PDB Description: crystal structure of the human p53 core domain mutant m133l/v203a/n239y/n268d at 1.9 a resolution.

PDB Compounds: (B:) Cellular tumor antigen p53

SCOPe Domain Sequences for d1uolb_:

Sequence; same for both SEQRES and ATOM records:

>d1uolb_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
vvvpyeppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvc
acpgrdrrteeenlr

Timeline for d1uolb_:

• d1uolb_ first appeared in SCOP 1.67
  
• d1uolb_ appears in SCOPe 2.01
  
• d1uolb_ appears in SCOPe 2.03
  
• d1uolb_ appears in the current release, SCOPe 2.08