![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.9: CAF1-like ribonuclease [102492] (3 proteins) |
![]() | Protein Pop2 RNase D domain [102493] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102494] (1 PDB entry) |
![]() | Domain d1uocb_: 1uoc B: [99687] complexed with ca, xe |
PDB Entry: 1uoc (more details), 2.3 Å
SCOPe Domain Sequences for d1uocb_:
Sequence, based on SEQRES records: (download)
>d1uocb_ c.55.3.9 (B:) Pop2 RNase D domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ppiflpppnylfvrdvwksnlysefavirqlvsqynhvsistefvgtlarpigtfrskvd yhyqtmranvdflnpiqlglslsdangnkpdngpstwqfnfefdpkkeimsteslellrk sginfekhenlgidvfefsqllmdsglmmddsvtwityhaaydlgflinilmndsmpnnk edfewwvhqympnfydlnlvykiiqefknpqlqqssqqqqqqqyslttladelglprfsi ftttggqsllmllsfcqlsklsmhkfpngtdfakyqgviygidgdq
>d1uocb_ c.55.3.9 (B:) Pop2 RNase D domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ppiflpppnylfvrdvwksnlysefavirqlvsqynhvsistefvgvdyhyqtmranvdf lnpiqlglslsdangnkpdngpstwqfnfefdpkkeimsteslellrksginfekhenlg idvfefsqllmdsglmmddsvtwityhaaydlgflinilmndsmpnnkedfewwvhqymp nfydlnlvykiislttladelglprfsiftttggqsllmllsfcqlsklsmhkfpngtdf akyqgviygidgdq
Timeline for d1uocb_: