Lineage for d1uoca_ (1uoc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124786Family c.55.3.9: CAF1-like ribonuclease [102492] (3 protein domains)
  6. 2124790Protein Pop2 RNase D domain [102493] (1 species)
  7. 2124791Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102494] (1 PDB entry)
  8. 2124792Domain d1uoca_: 1uoc A: [99686]
    complexed with ca, xe

Details for d1uoca_

PDB Entry: 1uoc (more details), 2.3 Å

PDB Description: x-ray structure of the rnase domain of the yeast pop2 protein
PDB Compounds: (A:) pop2

SCOPe Domain Sequences for d1uoca_:

Sequence, based on SEQRES records: (download)

>d1uoca_ c.55.3.9 (A:) Pop2 RNase D domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ppiflpppnylfvrdvwksnlysefavirqlvsqynhvsistefvgtlarpigtfrskvd
yhyqtmranvdflnpiqlglslsdangnkpdngpstwqfnfefdpkkeimsteslellrk
sginfekhenlgidvfefsqllmdsglmmddsvtwityhaaydlgflinilmndsmpnnk
edfewwvhqympnfydlnlvykiiqefknpqlqqssqqqqqqqyslttladelglprfsi
ftttggqsllmllsfcqlsklsmhkfpngtdfakyqgviygidgdq

Sequence, based on observed residues (ATOM records): (download)

>d1uoca_ c.55.3.9 (A:) Pop2 RNase D domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ppiflpppnylfvrdvwksnlysefavirqlvsqynhvsistefvgskvdyhyqtmranv
dflnpiqlglslsdangnkpdngpstwqfnfefdpkkeimsteslellrksginfekhen
lgidvfefsqllmdsglmmddsvtwityhaaydlgflinilmndsmpnnkedfewwvhqy
mpnfydlnlvykiiqefknqyslttladelglprfsiftttggqsllmllsfcqlsklsm
hkfpngtdfakyqgviygidgdq

SCOPe Domain Coordinates for d1uoca_:

Click to download the PDB-style file with coordinates for d1uoca_.
(The format of our PDB-style files is described here.)

Timeline for d1uoca_: