PDB entry 1uoc

View 1uoc on RCSB PDB site
Description: x-ray structure of the RNAse domain of the yeast pop2 protein
Class: hydrolase
Keywords: hydrolase, dedd nuclease, mRNA degradation, poly(a) tail, transcription regulation, repressor, phosphorylation.
Deposited on 2003-09-16, released 2003-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.239
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pop2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UOC
    • Uniprot P39008 (Start-288)
    Domains in SCOPe 2.07: d1uoca_
  • Chain 'B':
    Compound: pop2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UOC
    • Uniprot P39008 (Start-288)
    Domains in SCOPe 2.07: d1uocb_
  • Heterogens: CA, XE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uocA (A:)
    gamppiflpppnylfvrdvwksnlysefavirqlvsqynhvsistefvgtlarpigtfrs
    kvdyhyqtmranvdflnpiqlglslsdangnkpdngpstwqfnfefdpkkeimsteslel
    lrksginfekhenlgidvfefsqllmdsglmmddsvtwityhaaydlgflinilmndsmp
    nnkedfewwvhqympnfydlnlvykiiqefknpqlqqssqqqqqqqyslttladelglpr
    fsiftttggqsllmllsfcqlsklsmhkfpngtdfakyqgviygidgdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uocA (A:)
    ppiflpppnylfvrdvwksnlysefavirqlvsqynhvsistefvgskvdyhyqtmranv
    dflnpiqlglslsdangnkpdngpstwqfnfefdpkkeimsteslellrksginfekhen
    lgidvfefsqllmdsglmmddsvtwityhaaydlgflinilmndsmpnnkedfewwvhqy
    mpnfydlnlvykiiqefknqyslttladelglprfsiftttggqsllmllsfcqlsklsm
    hkfpngtdfakyqgviygidgdq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uocB (B:)
    gamppiflpppnylfvrdvwksnlysefavirqlvsqynhvsistefvgtlarpigtfrs
    kvdyhyqtmranvdflnpiqlglslsdangnkpdngpstwqfnfefdpkkeimsteslel
    lrksginfekhenlgidvfefsqllmdsglmmddsvtwityhaaydlgflinilmndsmp
    nnkedfewwvhqympnfydlnlvykiiqefknpqlqqssqqqqqqqyslttladelglpr
    fsiftttggqsllmllsfcqlsklsmhkfpngtdfakyqgviygidgdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uocB (B:)
    ppiflpppnylfvrdvwksnlysefavirqlvsqynhvsistefvgvdyhyqtmranvdf
    lnpiqlglslsdangnkpdngpstwqfnfefdpkkeimsteslellrksginfekhenlg
    idvfefsqllmdsglmmddsvtwityhaaydlgflinilmndsmpnnkedfewwvhqymp
    nfydlnlvykiislttladelglprfsiftttggqsllmllsfcqlsklsmhkfpngtdf
    akyqgviygidgdq