![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
![]() | Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) ![]() |
![]() | Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins) |
![]() | Protein DNA polymerase IV [103036] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [103037] (1 PDB entry) |
![]() | Domain d1unnd1: 1unn D:243-351 [99681] Other proteins in same PDB: d1unna1, d1unna2, d1unna3, d1unnb1, d1unnb2, d1unnb3, d1unnc2, d1unnd2 little finger domain only complexed with DNA polymerase III beta subunit protein/DNA complex; complexed with so4 |
PDB Entry: 1unn (more details), 1.9 Å
SCOPe Domain Sequences for d1unnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1unnd1 d.240.1.1 (D:243-351) DNA polymerase IV {Escherichia coli [TaxId: 562]} vgvertmaedihhwseceaiierlypelerrlakvkpdlliarqgvklkfddfqqttqeh vwprlnkadliatarktwderrggrgvrlvglhvtlldpqmerqlvlgl
Timeline for d1unnd1: