Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein) duplication: consists of three domains of this fold |
Protein DNA polymerase III, beta subunit [55981] (2 species) |
Species Escherichia coli [TaxId:562] [55982] (30 PDB entries) Uniprot P00583 |
Domain d1unna3: 1unn A:245-366 [99676] Other proteins in same PDB: d1unnc1, d1unnc2, d1unnd1, d1unnd2 protein/DNA complex; complexed with so4 |
PDB Entry: 1unn (more details), 1.9 Å
SCOPe Domain Sequences for d1unna3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1unna3 d.131.1.1 (A:245-366) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]} rrvlpknpdkhleagcdllkqafaraailsnekfrgvrlyvsenqlkitannpeqeeaee ildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayvvmpm rl
Timeline for d1unna3: