Lineage for d1unnc1 (1unn C:243-351)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008406Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 3008407Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 3008408Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 3008499Protein DNA polymerase IV [103036] (1 species)
  7. 3008500Species Escherichia coli [TaxId:562] [103037] (1 PDB entry)
  8. 3008501Domain d1unnc1: 1unn C:243-351 [99680]
    Other proteins in same PDB: d1unna1, d1unna2, d1unna3, d1unnb1, d1unnb2, d1unnb3, d1unnc2, d1unnd2
    little finger domain only complexed with DNA polymerase III beta subunit
    protein/DNA complex; complexed with so4

Details for d1unnc1

PDB Entry: 1unn (more details), 1.9 Å

PDB Description: complex of beta-clamp processivity factor and little finger domain of poliv
PDB Compounds: (C:) DNA polymerase IV

SCOPe Domain Sequences for d1unnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1unnc1 d.240.1.1 (C:243-351) DNA polymerase IV {Escherichia coli [TaxId: 562]}
vgvertmaedihhwseceaiierlypelerrlakvkpdlliarqgvklkfddfqqttqeh
vwprlnkadliatarktwderrggrgvrlvglhvtlldpqmerqlvlgl

SCOPe Domain Coordinates for d1unnc1:

Click to download the PDB-style file with coordinates for d1unnc1.
(The format of our PDB-style files is described here.)

Timeline for d1unnc1: