Lineage for d1umnk_ (1umn K:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353826Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 353827Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 353828Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 353960Protein Dodecameric ferritin homolog [47250] (9 species)
  7. 354111Species Streptococcus suis [101134] (1 PDB entry)
  8. 354122Domain d1umnk_: 1umn K: [99617]

Details for d1umnk_

PDB Entry: 1umn (more details), 1.95 Å

PDB Description: crystal structure of dps-like peroxide resistance protein (dpr) from streptococcus suis

SCOP Domain Sequences for d1umnk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umnk_ a.25.1.1 (K:) Dodecameric ferritin homolog {Streptococcus suis}
sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
dsvtndifnvakasiekhiwmlqaelgqapkl

SCOP Domain Coordinates for d1umnk_:

Click to download the PDB-style file with coordinates for d1umnk_.
(The format of our PDB-style files is described here.)

Timeline for d1umnk_: