Class a: All alpha proteins [46456] (202 folds) |
Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (3 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (7 proteins) |
Protein Dodecameric ferritin homolog [47250] (9 species) |
Species Streptococcus suis [101134] (1 PDB entry) |
Domain d1umnc_: 1umn C: [99609] |
PDB Entry: 1umn (more details), 1.95 Å
SCOP Domain Sequences for d1umnc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umnc_ a.25.1.1 (C:) Dodecameric ferritin homolog {Streptococcus suis} ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd svtndifnvakasiekhiwmlqaelgqapkl
Timeline for d1umnc_: