Lineage for d1umda_ (1umd A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 986456Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 986457Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 986925Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 986929Protein Branched-chain alpha-keto acid dehydrogenase, PP module [88767] (2 species)
  7. 986950Species Thermus thermophilus [TaxId:274] [102337] (4 PDB entries)
  8. 986951Domain d1umda_: 1umd A: [99599]
    Other proteins in same PDB: d1umdb1, d1umdb2, d1umdd1, d1umdd2
    complexed with coi, mg, tdp

Details for d1umda_

PDB Entry: 1umd (more details), 1.9 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate
PDB Compounds: (A:) 2-oxo acid dehydrogenase alpha subunit

SCOPe Domain Sequences for d1umda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]}
hrfetfteepirligeegewlgdfpldlegeklrrlyrdmlaarmlderytilirtgkts
fiapaagheaaqvaiahairpgfdwvfpyyrdhglalalgiplkellgqmlatkadpnkg
rqmpehpgskalnfftvaspiashvppaagaaismkllrtgqvavctfgdgatsegdwya
ginfaavqgapavfiaennfyaisvdyrhqthsptiadkahafgipgylvdgmdvlasyy
vvkeaverarrgegpslvelrvyrygphssadddsryrpkeevafwrkkdpiprfrrfle
arglwneeweedvreeiraelerglkeaeeagpvppewmfedvfaekpwhllrqeallke
el

SCOPe Domain Coordinates for d1umda_:

Click to download the PDB-style file with coordinates for d1umda_.
(The format of our PDB-style files is described here.)

Timeline for d1umda_: