Lineage for d1uk5a_ (1uk5 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1081581Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1081791Superfamily a.7.7: BAG domain [63491] (1 family) (S)
  5. 1081792Family a.7.7.1: BAG domain [63492] (4 proteins)
    Pfam PF02179
    this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain
  6. 1081808Protein BAG-family molecular chaperone regulator-3 [101080] (1 species)
    Bcl2-associated athanogene 3
  7. 1081809Species Mouse (Mus musculus) [TaxId:10090] [101081] (1 PDB entry)
  8. 1081810Domain d1uk5a_: 1uk5 A: [99487]

Details for d1uk5a_

PDB Entry: 1uk5 (more details)

PDB Description: solution structure of the murine bag domain of bcl2-associated athanogene 3
PDB Compounds: (A:) BAG-family molecular chaperone regulator-3

SCOPe Domain Sequences for d1uk5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uk5a_ a.7.7.1 (A:) BAG-family molecular chaperone regulator-3 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgapaepaapksgeaetppkhpgvlkveailekvqgleqavdsfegkktdkkylm
ieeyltkellaldsvdpegradvrqarrdgvrkvqtilekleqkasgpssg

SCOPe Domain Coordinates for d1uk5a_:

Click to download the PDB-style file with coordinates for d1uk5a_.
(The format of our PDB-style files is described here.)

Timeline for d1uk5a_: