Lineage for d1uk5a1 (1uk5 A:8-105)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. Superfamily a.7.7: BAG domain [63491] (1 family) (S)
  5. Family a.7.7.1: BAG domain [63492] (4 proteins)
    Pfam PF02179
  6. Protein BAG-family molecular chaperone regulator-3 [101080] (1 species)
    Bcl2-associated athanogene 3
  7. Species Mouse (Mus musculus) [TaxId:10090] [101081] (1 PDB entry)
  8. Domain d1uk5a1: 1uk5 A:8-105 [99487]
    Other proteins in same PDB: d1uk5a2, d1uk5a3

Details for d1uk5a1

PDB Entry: 1uk5 (more details)

PDB Description: Solution structure of the Murine BAG domain of Bcl2-associated athanogene 3
PDB Compounds: (A:) BAG-family molecular chaperone regulator-3

SCOPe Domain Sequences for d1uk5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uk5a1 a.7.7.1 (A:8-105) BAG-family molecular chaperone regulator-3 {Mouse (Mus musculus) [TaxId: 10090]}
apaepaapksgeaetppkhpgvlkveailekvqgleqavdsfegkktdkkylmieeyltk
ellaldsvdpegradvrqarrdgvrkvqtilekleqka

SCOPe Domain Coordinates for d1uk5a1 are not available.

Timeline for d1uk5a1:

Domains from same chain:
(mouse over for more information)
d1uk5a2, d1uk5a3