Lineage for d1ujza_ (1ujz A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 912781Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 912866Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) (S)
  5. 912867Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)
  6. 912868Protein ImmE7 protein (Im7) [47347] (1 species)
  7. 912869Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)
  8. 912885Domain d1ujza_: 1ujz A: [99475]
    Other proteins in same PDB: d1ujzb_
    computationally designed interface with the colicin E7 DNase domain

Details for d1ujza_

PDB Entry: 1ujz (more details), 2.1 Å

PDB Description: crystal structure of the e7_c/im7_c complex; a computationally designed interface between the colicin e7 dnase and the im7 immunity protein
PDB Compounds: (A:) Designed Colicin E7 immunity protein

SCOPe Domain Sequences for d1ujza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujza_ a.28.2.1 (A:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
melknsisdyteaefvqllkeiekenvaatddvlyvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

SCOPe Domain Coordinates for d1ujza_:

Click to download the PDB-style file with coordinates for d1ujza_.
(The format of our PDB-style files is described here.)

Timeline for d1ujza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ujzb_