![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) ![]() |
![]() | Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins) |
![]() | Protein ImmE7 protein (Im7) [47347] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [47348] (6 PDB entries) |
![]() | Domain d1ujza_: 1ujz A: [99475] Other proteins in same PDB: d1ujzb_ computationally designed interface with the colicin E7 DNase domain mutant |
PDB Entry: 1ujz (more details), 2.1 Å
SCOP Domain Sequences for d1ujza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ujza_ a.28.2.1 (A:) ImmE7 protein (Im7) {Escherichia coli} melknsisdyteaefvqllkeiekenvaatddvlyvllehfvkitehpdgtdliyypsdn rddspegivkeikewraangkpgfkqg
Timeline for d1ujza_: