SCOPe 2.08: Domain d1ujwb_: 1ujw B:

Lineage for d1ujwb_ (1ujw B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
   this is not a true fold; contains at least two very long antiparallel helices

4. Superfamily h.4.9: Colicin E3 receptor domain [69985] (1 family)

5. Family h.4.9.1: Colicin E3 receptor domain [69986] (1 protein)

6. Protein Colicin E3 receptor domain [69987] (1 species)

7. Species Escherichia coli [TaxId:562] [69988] (4 PDB entries)

8. Domain d1ujwb_: 1ujw B: [99472]
   Other proteins in same PDB: d1ujwa_
   complexed with BtuB
   complexed with aae, gol, gp1, lda, lim

Details for d1ujwb_

PDB Entry: 1ujw, 2.75 Å

PDB Description: structure of the complex between btub and colicin e3 receptor binding domain

PDB Compounds: (B:) Colicin E3

SCOPe Domain Sequences for d1ujwb_:

Sequence; same for both SEQRES and ATOM records:

>d1ujwb_ h.4.9.1 (B:) Colicin E3 receptor domain {Escherichia coli [TaxId: 562]}
yeraraelnqanedvarnqerqakavqvynsrkseldaanktladaiaeikqfnrfahdp
magghrmwqmaglkaqraqtdvnnkqaafdaaakeksdadaalssamesrkkkedk

Timeline for d1ujwb_:

• d1ujwb_ first appeared in SCOP 1.67
  
• d1ujwb_ appears in SCOPe 2.07