Lineage for d1ujwb_ (1ujw B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2646825Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2646930Superfamily h.4.9: Colicin E3 receptor domain [69985] (1 family) (S)
  5. 2646931Family h.4.9.1: Colicin E3 receptor domain [69986] (1 protein)
  6. 2646932Protein Colicin E3 receptor domain [69987] (1 species)
  7. 2646933Species Escherichia coli [TaxId:562] [69988] (4 PDB entries)
  8. 2646936Domain d1ujwb_: 1ujw B: [99472]
    Other proteins in same PDB: d1ujwa_
    complexed with BtuB
    complexed with aae, gol, gp1, lda, lim

Details for d1ujwb_

PDB Entry: 1ujw (more details), 2.75 Å

PDB Description: structure of the complex between btub and colicin e3 receptor binding domain
PDB Compounds: (B:) Colicin E3

SCOPe Domain Sequences for d1ujwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujwb_ h.4.9.1 (B:) Colicin E3 receptor domain {Escherichia coli [TaxId: 562]}
yeraraelnqanedvarnqerqakavqvynsrkseldaanktladaiaeikqfnrfahdp
magghrmwqmaglkaqraqtdvnnkqaafdaaakeksdadaalssamesrkkkedk

SCOPe Domain Coordinates for d1ujwb_:

Click to download the PDB-style file with coordinates for d1ujwb_.
(The format of our PDB-style files is described here.)

Timeline for d1ujwb_: