Lineage for d1uhaa2 (1uha A:43-82)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1061533Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 1061534Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. 1061570Protein Lectin-D [103524] (1 species)
    consists of two homologous domains
  7. 1061571Species American pokeweed (Phytolacca americana) [TaxId:3527] [103525] (3 PDB entries)
  8. 1061573Domain d1uhaa2: 1uha A:43-82 [99396]
    isoform D2
    complexed with ca

Details for d1uhaa2

PDB Entry: 1uha (more details), 1.5 Å

PDB Description: Crystal Structure of Pokeweed Lectin-D2
PDB Compounds: (A:) lectin-D2

SCOPe Domain Sequences for d1uhaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhaa2 g.3.1.1 (A:43-82) Lectin-D {American pokeweed (Phytolacca americana) [TaxId: 3527]}
wrcgrdfggrlceedmccskygwcgysddhcedgcqsqcd

SCOPe Domain Coordinates for d1uhaa2:

Click to download the PDB-style file with coordinates for d1uhaa2.
(The format of our PDB-style files is described here.)

Timeline for d1uhaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uhaa1