SCOP 1.67: Domain d1uhaa2: 1uha A:43-82

Lineage for d1uhaa2 (1uha A:43-82)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families)

5. Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (5 proteins)

6. Protein Lectin-D [103524] (1 species)
   consists of two homologous domains

7. Species American pokeweed (Phytolacca americana) [TaxId:3527] [103525] (3 PDB entries)

8. Domain d1uhaa2: 1uha A:43-82 [99396]
   isoform D2
   complexed with ca

Details for d1uhaa2

PDB Entry: 1uha, 1.5 Å

PDB Description: Crystal Structure of Pokeweed Lectin-D2

SCOP Domain Sequences for d1uhaa2:

Sequence; same for both SEQRES and ATOM records:

>d1uhaa2 g.3.1.1 (A:43-82) Lectin-D {American pokeweed (Phytolacca americana)}
wrcgrdfggrlceedmccskygwcgysddhcedgcqsqcd

Timeline for d1uhaa2:

• d1uhaa2 is new in SCOP 1.67
  
• d1uhaa2 appears in SCOP 1.69
  
• d1uhaa2 appears in the current release, SCOPe 2.08