Lineage for d1ufqc_ (1ufq C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163588Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (5 proteins)
  6. 1163612Protein Uridine-cytidine kinase 2 [102360] (1 species)
  7. 1163613Species Human (Homo sapiens) [TaxId:9606] [102361] (6 PDB entries)
  8. 1163626Domain d1ufqc_: 1ufq C: [99352]

Details for d1ufqc_

PDB Entry: 1ufq (more details), 2.5 Å

PDB Description: Crystal structure of ligand-free human uridine-cytidine kinase 2
PDB Compounds: (C:) Uridine-cytidine kinase 2

SCOPe Domain Sequences for d1ufqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufqc_ c.37.1.6 (C:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
ptkkyadviiprgadnlvainlivqhiqdiln

SCOPe Domain Coordinates for d1ufqc_:

Click to download the PDB-style file with coordinates for d1ufqc_.
(The format of our PDB-style files is described here.)

Timeline for d1ufqc_: