SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ufqc_ (1ufq C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110026Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 protein domains)
  6. 2110050Protein Uridine-cytidine kinase 2 [102360] (1 species)
  7. 2110051Species Human (Homo sapiens) [TaxId:9606] [102361] (6 PDB entries)
  8. 2110064Domain d1ufqc_: 1ufq C: [99352]

Details for d1ufqc_

PDB Entry: 1ufq (more details), 2.5 Å

PDB Description: Crystal structure of ligand-free human uridine-cytidine kinase 2
PDB Compounds: (C:) Uridine-cytidine kinase 2

SCOPe Domain Sequences for d1ufqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufqc_ c.37.1.6 (C:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
ptkkyadviiprgadnlvainlivqhiqdiln

SCOPe Domain Coordinates for d1ufqc_:

Click to download the PDB-style file with coordinates for d1ufqc_.
(The format of our PDB-style files is described here.)

Timeline for d1ufqc_: