![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein Snake coagglutinin alpha chain [88861] (10 species) heterodimeric coagulation factors IX/X-binding protein (IX/X-BP) |
![]() | Species Puff adder (Bitis arietans), bitiscetin [TaxId:8692] [88866] (2 PDB entries) |
![]() | Domain d1uexa_: 1uex A: [99282] Other proteins in same PDB: d1uexb_, d1uexc_ complexed with the von Willebrand factor a1 domain |
PDB Entry: 1uex (more details), 2.85 Å
SCOPe Domain Sequences for d1uexa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uexa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} gclpdwssykghcykvfkkvgtwedaekfcvensghlasidskeeadfvtklasqtltkf vydawiglrdesktqqcspqwtdgssvvyenvdeptkcfgldvhteyrtwtdlpcgeknp ficks
Timeline for d1uexa_: