Lineage for d1uexc_ (1uex C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378146Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1378147Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 1378148Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 1378258Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species)
  7. 1378259Species Human (Homo sapiens) [TaxId:9606] [53307] (9 PDB entries)
  8. 1378266Domain d1uexc_: 1uex C: [99284]
    Other proteins in same PDB: d1uexa_, d1uexb_
    complexed with bitiscetin

Details for d1uexc_

PDB Entry: 1uex (more details), 2.85 Å

PDB Description: Crystal structure of von Willebrand Factor A1 domain complexed with snake venom bitiscetin
PDB Compounds: (C:) von willebrand factor

SCOPe Domain Sequences for d1uexc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uexc_ c.62.1.1 (C:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
epplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhd
gshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasriall
lmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssv
deleqqrdeivsylcdlapeap

SCOPe Domain Coordinates for d1uexc_:

Click to download the PDB-style file with coordinates for d1uexc_.
(The format of our PDB-style files is described here.)

Timeline for d1uexc_: