Lineage for d1uewa_ (1uew A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666575Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 666677Protein Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) [101719] (1 species)
  7. 666678Species Human (Homo sapiens) [TaxId:9606] [101720] (5 PDB entries)
  8. 666681Domain d1uewa_: 1uew A: [99281]
    structural genomics; fourth PDZ domain

Details for d1uewa_

PDB Entry: 1uew (more details)

PDB Description: solution structure of the forth pdz domain of human atrophin-1 interacting protein 1 (kiaa0705 protein)
PDB Compounds: (A:) membrane associated guanylate kinase inverted-2 (magi-2)

SCOP Domain Sequences for d1uewa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgslqtsdvvihrkenegfgfviisslnrpesgstitvphkigriidgspadrca
klkvgdrilavngqsiinmphadivklikdaglsvtlriipqeelnspsgpssg

SCOP Domain Coordinates for d1uewa_:

Click to download the PDB-style file with coordinates for d1uewa_.
(The format of our PDB-style files is described here.)

Timeline for d1uewa_: