PDB entry 1uew

View 1uew on RCSB PDB site
Description: Solution Structure of The forth PDZ Domain of Human Atrophin-1 Interacting Protein 1 (KIAA0705 Protein)
Class: signaling protein
Keywords: Atrophin-1 Interacting Protein 1, PDZ Domain, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-05-22, released 2003-11-22
The last revision prior to the SCOP 1.73 freeze date was dated 2003-11-22, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: membrane associated guanylate kinase inverted-2 (magi-2)
    Species: HOMO SAPIENS
    Gene: KAZUSA cDNA hg03359
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86UL8 (7-107)
      • cloning artifact (0-6)
      • cloning artifact (108-113)
    Domains in SCOP 1.73: d1uewa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uewA (A:)
    gssgssgslqtsdvvihrkenegfgfviisslnrpesgstitvphkigriidgspadrca
    klkvgdrilavngqsiinmphadivklikdaglsvtlriipqeelnspsgpssg