Lineage for d1ueva1 (1uev A:143-257)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735618Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 2735619Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 2735644Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein)
    automatically mapped to Pfam PF09249
  6. 2735645Protein tRNA nucleotidyltransferase, second domain [101275] (1 species)
  7. 2735646Species Archaeoglobus fulgidus [TaxId:2234] [101276] (26 PDB entries)
    Uniprot O28126
  8. 2735661Domain d1ueva1: 1uev A:143-257 [99278]
    Other proteins in same PDB: d1ueva2, d1ueva3
    complexed with atp, ca, mg

Details for d1ueva1

PDB Entry: 1uev (more details), 2.7 Å

PDB Description: Divergent evolutions of trinucleotide polymerization revealed by an archaeal CCA-adding enzyme structure
PDB Compounds: (A:) tRNA nucleotidyltransferase

SCOPe Domain Sequences for d1ueva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ueva1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeoglobus fulgidus [TaxId: 2234]}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

SCOPe Domain Coordinates for d1ueva1:

Click to download the PDB-style file with coordinates for d1ueva1.
(The format of our PDB-style files is described here.)

Timeline for d1ueva1: