Lineage for d1ueva1 (1uev A:143-257)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362148Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 362149Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (3 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 362162Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein)
  6. 362163Protein tRNA nucleotidyltransferase, second domain [101275] (1 species)
  7. 362164Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [101276] (7 PDB entries)
  8. 362171Domain d1ueva1: 1uev A:143-257 [99278]
    Other proteins in same PDB: d1ueva2, d1ueva3
    complexed with atp, ca, mg

Details for d1ueva1

PDB Entry: 1uev (more details), 2.7 Å

PDB Description: Divergent evolutions of trinucleotide polymerization revealed by an archaeal CCA-adding enzyme structure

SCOP Domain Sequences for d1ueva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ueva1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeon Archaeoglobus fulgidus}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

SCOP Domain Coordinates for d1ueva1:

Click to download the PDB-style file with coordinates for d1ueva1.
(The format of our PDB-style files is described here.)

Timeline for d1ueva1: