Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins) barrel, closed; n=5, S=8 |
Protein Inorganic pyrophosphatase [50326] (9 species) eukaryotic enzyme has additional secondary structures at both N- and C-termini |
Species Pyrococcus horikoshii [TaxId:53953] [101771] (1 PDB entry) |
Domain d1udeb_: 1ude B: [99209] |
PDB Entry: 1ude (more details), 2.66 Å
SCOPe Domain Sequences for d1udeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udeb_ b.40.5.1 (B:) Inorganic pyrophosphatase {Pyrococcus horikoshii [TaxId: 53953]} fhdlepgpnvpevvyalieipkgsrnkyeldketgllkldrvlytpfhypvdygiiprtw yedgdpfdimvimreptypltiiearpiglfkmidsgdkdykvlavpvedpyfkdwkdis dvpkafldeiahffkrykelegkeiivegwegaeaakreilraiemy
Timeline for d1udeb_: