PDB entry 1ude

View 1ude on RCSB PDB site
Description: Crystal structure of the Inorganic pyrophosphatase from the hyperthermophilic archaeon Pyrococcus horikoshii OT3
Class: hydrolase
Keywords: inorganic pyrophosphatase X-ray crystallographic analysis, HYDROLASE
Deposited on 2003-04-29, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.232
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1udea_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1udeb_
  • Chain 'C':
    Compound: inorganic pyrophosphatase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1udec_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1udeA (A:)
    hhhhhhssglvprgshmmnpfhdlepgpnvpevvyalieipkgsrnkyeldketgllkld
    rvlytpfhypvdygiiprtwyedgdpfdimvimreptypltiiearpiglfkmidsgdkd
    ykvlavpvedpyfkdwkdisdvpkafldeiahffkrykelegkeiivegwegaeaakrei
    lraiemykekfgkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udeA (A:)
    fhdlepgpnvpevvyalieipkgsrnkyeldketgllkldrvlytpfhypvdygiiprtw
    yedgdpfdimvimreptypltiiearpiglfkmidsgdkdykvlavpvedpyfkdwkdis
    dvpkafldeiahffkrykelegkeiivegwegaeaakreilraiemyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1udeB (B:)
    hhhhhhssglvprgshmmnpfhdlepgpnvpevvyalieipkgsrnkyeldketgllkld
    rvlytpfhypvdygiiprtwyedgdpfdimvimreptypltiiearpiglfkmidsgdkd
    ykvlavpvedpyfkdwkdisdvpkafldeiahffkrykelegkeiivegwegaeaakrei
    lraiemykekfgkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udeB (B:)
    fhdlepgpnvpevvyalieipkgsrnkyeldketgllkldrvlytpfhypvdygiiprtw
    yedgdpfdimvimreptypltiiearpiglfkmidsgdkdykvlavpvedpyfkdwkdis
    dvpkafldeiahffkrykelegkeiivegwegaeaakreilraiemy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1udeC (C:)
    hhhhhhssglvprgshmmnpfhdlepgpnvpevvyalieipkgsrnkyeldketgllkld
    rvlytpfhypvdygiiprtwyedgdpfdimvimreptypltiiearpiglfkmidsgdkd
    ykvlavpvedpyfkdwkdisdvpkafldeiahffkrykelegkeiivegwegaeaakrei
    lraiemykekfgkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udeC (C:)
    fhdlepgpnvpevvyalieipkgsrnkyeldketgllkldrvlytpfhypvdygiiprtw
    yedgdpfdimvimreptypltiiearpiglfkmidsgdkdykvlavpvedpyfkdwkdis
    dvpkafldeiahffkrykelegkeiivegwegaeaakreilraiemy