Lineage for d1udec_ (1ude C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790735Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2790736Protein Inorganic pyrophosphatase [50326] (9 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 2790815Species Pyrococcus horikoshii [TaxId:53953] [101771] (1 PDB entry)
  8. 2790818Domain d1udec_: 1ude C: [99210]

Details for d1udec_

PDB Entry: 1ude (more details), 2.66 Å

PDB Description: crystal structure of the inorganic pyrophosphatase from the hyperthermophilic archaeon pyrococcus horikoshii ot3
PDB Compounds: (C:) inorganic pyrophosphatase

SCOPe Domain Sequences for d1udec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udec_ b.40.5.1 (C:) Inorganic pyrophosphatase {Pyrococcus horikoshii [TaxId: 53953]}
fhdlepgpnvpevvyalieipkgsrnkyeldketgllkldrvlytpfhypvdygiiprtw
yedgdpfdimvimreptypltiiearpiglfkmidsgdkdykvlavpvedpyfkdwkdis
dvpkafldeiahffkrykelegkeiivegwegaeaakreilraiemy

SCOPe Domain Coordinates for d1udec_:

Click to download the PDB-style file with coordinates for d1udec_.
(The format of our PDB-style files is described here.)

Timeline for d1udec_: