Lineage for d1ud0c_ (1ud0 C:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families) 
Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins) 
Protein DnaK [100936] (2 species) 
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101098] (1 PDB entry) 
Domain d1ud0c_: 1ud0 C: [99200]
C-terminal subdomain only; forms helix-swapped dimer
complexed with na
Details for d1ud0c_
PDB Entry: 1ud0 (more details), 3.45 Å
PDB Description: crystal structure of the c-terminal 10-kda subdomain of hsc70
PDB Compounds: (C:) 70 kDa heat-shock-like proteinSCOPe Domain Sequences for d1ud0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ud0c_ a.8.4.1 (C:) DnaK {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lvprgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefe
hqqkelekvcnpiitklyqsaggmpggm
SCOPe Domain Coordinates for d1ud0c_:
Click to download the PDB-style file with coordinates for d1ud0c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ud0c_:
- d1ud0c_ first appeared in SCOP 1.67
- d1ud0c_ appears in SCOPe 2.04
- d1ud0c_ is called d1ud0c1 in SCOPe 2.06
- d1ud0c_ appears in the current release, SCOPe 2.08, called d1ud0c1
View in 3D
