SCOPe 2.04: Domain d1ud0c_: 1ud0 C:

Lineage for d1ud0c_ (1ud0 C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families)

5. Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins)

6. Protein DnaK [100936] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101098] (1 PDB entry)

8. Domain d1ud0c_: 1ud0 C: [99200]
   C-terminal subdomain only; forms helix-swapped dimer
   complexed with na

Details for d1ud0c_

PDB Entry: 1ud0, 3.45 Å

PDB Description: crystal structure of the c-terminal 10-kda subdomain of hsc70

PDB Compounds: (C:) 70 kDa heat-shock-like protein

SCOPe Domain Sequences for d1ud0c_:

Sequence; same for both SEQRES and ATOM records:

>d1ud0c_ a.8.4.1 (C:) DnaK {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lvprgshmlesyafnmkatvedeklqgkindedkqkildkcneiiswldknqtaekeefe
hqqkelekvcnpiitklyqsaggmpggm

Timeline for d1ud0c_:

• d1ud0c_ first appeared in SCOP 1.67
  
• d1ud0c_ appears in SCOPe 2.03
  
• d1ud0c_ appears in SCOPe 2.05
  
• d1ud0c_ appears in the current release, SCOPe 2.08, called d1ud0c1